OR7E24 Peptide - C-terminal region
OR7E24 Peptide - C-terminal region
Product Specifications
Product Name Alternative
HSHT2, OR19-8, OR7E24P, OR7E24Q
UniProt
Q6IFN5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR7E24 Rabbit Polyclonal Antibody (orb587845) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001073404
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IYFMGAIFGCLPISGILFSYYKIVSPILRVPTSDGKYKAFSTCGSHLAVV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
#29116 1x 1 mL
Phaseolus Vulgaris Leucoagglutinin (PHA-L), CF®568 Conjugate
Sign In for Pricing
View Details 
BNC400142-100 1x 100 µL
Beta-2 Microglobulin (B2M) (BBM.1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details