Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF552 Peptide - middle region

ZNF552 Peptide - middle region

Product Specifications

UniProt

Q9H707

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF552 Rabbit Polyclonal Antibody (orb587849) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079038

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RSGLLQQEATHTGKSNSKTECVSLFHGGKSHYSCGGCMKHFSTKDILSQH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myc Antibody
F47612-0.08ML 0.08 mL

Myc Antibody

Sign In for Pricing
View Details
Human PGF Antibody Pair Set
E-KAB-0221 50 µL & 100 µg

Human PGF Antibody Pair Set

Sign In for Pricing
View Details
P53 (Tumor Suppressor Protein) (TP53/2719), CF405S conjugate, 0.1mg/mL
BNC042719-500 1x 500 µL

P53 (Tumor Suppressor Protein) (TP53/2719), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACE1 Polyclonal Antibody
E-AB-70116-01 60 µL

ACE1 Polyclonal Antibody

Sign In for Pricing
View Details
ACE1 Polyclonal Antibody
E-AB-70116-02 120 µL

ACE1 Polyclonal Antibody

Sign In for Pricing
View Details
ACE1 Polyclonal Antibody
E-AB-70116-03 200 µL

ACE1 Polyclonal Antibody

Sign In for Pricing
View Details