Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF552 Peptide - middle region

ZNF552 Peptide - middle region

Product Specifications

UniProt

Q9H707

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF552 Rabbit Polyclonal Antibody (orb587849) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079038

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RSGLLQQEATHTGKSNSKTECVSLFHGGKSHYSCGGCMKHFSTKDILSQH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,2-Dihydroxynaphthalene
TRC-D454168-500MG 500 mg

1,2-Dihydroxynaphthalene

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS620339 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
TFIIB (GTF2B) Mouse Monoclonal Antibody [Clone ID: OTI2A7]
CF808571 100 µg

TFIIB (GTF2B) Mouse Monoclonal Antibody [Clone ID: OTI2A7]

Sign In for Pricing
View Details
1-Boc-4-(6-aminopyridin-3-yl)piperazine-d4
TRC-B621162-50MG 50 mg

1-Boc-4-(6-aminopyridin-3-yl)piperazine-d4

Sign In for Pricing
View Details
SLC22A6 Rabbit Polyclonal Antibody
AP20669PU-N 100 µg

SLC22A6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human EXOSC1 activation kit by CRISPRa
GA109497 1 Kit

Human EXOSC1 activation kit by CRISPRa

Sign In for Pricing
View Details