Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF90 Peptide - C-terminal region

ZNF90 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HTF9

UniProt

Q03938

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF90 Rabbit Polyclonal Antibody (orb587850) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009069

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CQECDKVFKRSSALSTHKIIHSGEKPYKCEECGKAFKRSSNLTTHKISHT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SETMAR Polyclonal Antibody
E-AB-52907-01 20 µL

SETMAR Polyclonal Antibody

Sign In for Pricing
View Details
SETMAR Polyclonal Antibody
E-AB-52907-02 60 µL

SETMAR Polyclonal Antibody

Sign In for Pricing
View Details
SETMAR Polyclonal Antibody
E-AB-52907-03 120 µL

SETMAR Polyclonal Antibody

Sign In for Pricing
View Details
SETMAR Polyclonal Antibody
E-AB-52907-04 200 µL

SETMAR Polyclonal Antibody

Sign In for Pricing
View Details
C2orf81 CytoSection
TS427769P5 25 Slides

C2orf81 CytoSection

Sign In for Pricing
View Details
Guinea pig ATP synthase subunit epsilon, mitochondrial (ATP5E) ELISA Kit
MBS7224812-01 48 Well

Guinea pig ATP synthase subunit epsilon, mitochondrial (ATP5E) ELISA Kit

Sign In for Pricing
View Details