Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF90 Peptide - C-terminal region

ZNF90 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HTF9

UniProt

Q03938

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF90 Rabbit Polyclonal Antibody (orb587850) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009069

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CQECDKVFKRSSALSTHKIIHSGEKPYKCEECGKAFKRSSNLTTHKISHT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone-H3 Antibody
abx233890 100 µg

Histone-H3 Antibody

Sign In for Pricing
View Details
Caprine CCL11 (Eotaxin-1) Recombinant Protein
RP1083G-01 5 µg

Caprine CCL11 (Eotaxin-1) Recombinant Protein

Sign In for Pricing
View Details
Caprine CCL11 (Eotaxin-1) Recombinant Protein
RP1083G-02 25 µg

Caprine CCL11 (Eotaxin-1) Recombinant Protein

Sign In for Pricing
View Details
Caprine CCL11 (Eotaxin-1) Recombinant Protein
RP1083G-03 100 µg

Caprine CCL11 (Eotaxin-1) Recombinant Protein

Sign In for Pricing
View Details
Rat Filamin B Beta FLNB ELISA Kit
BG-RAT10957 1 Each

Rat Filamin B Beta FLNB ELISA Kit

Sign In for Pricing
View Details
HPS3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV623199 1.0 µg DNA

HPS3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details