Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PALMD Peptide - middle region

PALMD Peptide - middle region

Product Specifications

Product Name Alternative

C1orf11, PALML

UniProt

Q9NP74

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PALMD Rabbit Polyclonal Antibody (orb573716) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060204

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HAELVVIDDEEEEDEGEAEKPSYHPIAPHSQVYQPAKPTPLPRKRSEASP

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Osteosarcoma Organoid Kit
orb3169846-01 100 mL

Human Osteosarcoma Organoid Kit

Sign In for Pricing
View Details
Human Osteosarcoma Organoid Kit
orb3169846-02 500 mL

Human Osteosarcoma Organoid Kit

Sign In for Pricing
View Details
ZIC5 Protein Lysate (Mouse) with C-HA Tag
51250034 100 µg

ZIC5 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Gm6927 Protein Lysate (Mouse) with C-HA Tag
22190034 100 µg

Gm6927 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
PDGFR-alpha discontinued
540840-01 30ul

PDGFR-alpha discontinued

Sign In for Pricing
View Details
PDGFR-alpha discontinued
540840-02 100 µL

PDGFR-alpha discontinued

Sign In for Pricing
View Details