PALMD Peptide - middle region
PALMD Peptide - middle region
Product Specifications
Product Name Alternative
C1orf11, PALML
UniProt
Q9NP74
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PALMD Rabbit Polyclonal Antibody (orb573716) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_060204
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HAELVVIDDEEEEDEGEAEKPSYHPIAPHSQVYQPAKPTPLPRKRSEASP
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb1807169-01 48 Tests
Human Tumor Necrosis Factor Receptor Superfamily, Member 1A (TNFRSF1A) ELISA Kit
Sign In for Pricing
View Details orb1807169-02 96 Tests
Human Tumor Necrosis Factor Receptor Superfamily, Member 1A (TNFRSF1A) ELISA Kit
Sign In for Pricing
View Details 360984-01 50 µL
PNKP (Bifunctional Polynucleotide, Phosphatase/Kinase, DNA 5'-Kinase/3'-Phosphatase, Polynucleotide Kinase-3'-Phosphatase) discontinued
Sign In for Pricing
View Details 360984-02 100 µL
PNKP (Bifunctional Polynucleotide, Phosphatase/Kinase, DNA 5'-Kinase/3'-Phosphatase, Polynucleotide Kinase-3'-Phosphatase) discontinued
Sign In for Pricing
View Details