Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTERF1 Peptide - C-terminal region

MTERF1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MTERF

UniProt

B4DPR9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MTERF1 Rabbit Polyclonal Antibody (orb574742) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001288063.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DFVRKIIFKNPFILIQSTKRVKANIEFLRSTFNLNSEELLVLICGPGAEI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Ovary
CS634918 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
10-Deazaminopterin
TRC-D195640-100MG 100 mg

10-Deazaminopterin

Sign In for Pricing
View Details
N4BP2L2 Mouse Monoclonal Antibody [Clone ID: OTI7F5]
CF804202 100 µg

N4BP2L2 Mouse Monoclonal Antibody [Clone ID: OTI7F5]

Sign In for Pricing
View Details
FLI1 Human Gene Knockout Kit (CRISPR)
KN200695 1 Kit

FLI1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NSUN5 Rabbit Polyclonal Antibody
HA500544 100 µL

NSUN5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
a-Ethyl-benzeneacetyl Chloride
TRC-E899755-25G 25 g

a-Ethyl-benzeneacetyl Chloride

Sign In for Pricing
View Details