MTERF1 Peptide - C-terminal region
MTERF1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
MTERF
UniProt
B4DPR9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MTERF1 Rabbit Polyclonal Antibody (orb574742) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001288063.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DFVRKIIFKNPFILIQSTKRVKANIEFLRSTFNLNSEELLVLICGPGAEI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![RAD21 Mouse Monoclonal Antibody [Clone ID: OTI11F10]](https://cdn.genprice.uk/products/937/68dd18bb061270361e908a90/imageurl/cf811186.webp)
CF811186 100 µg
RAD21 Mouse Monoclonal Antibody [Clone ID: OTI11F10]
Sign In for Pricing
View Details 
PR1001-R-1000 1 Each
Accuris Taq Master Mix Red Dye, 2X conc., 1000 reactions
Sign In for Pricing
View Details