Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GABRB2 Peptide - N-terminal region

GABRB2 Peptide - N-terminal region

Product Specifications

UniProt

P47870

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GABRB2 Rabbit Polyclonal Antibody (orb329826) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAMBP Antibody
KC-1291-01 50 μL

STAMBP Antibody

Sign In for Pricing
View Details
STAMBP Antibody
KC-1291-02 100 µL

STAMBP Antibody

Sign In for Pricing
View Details
STAMBP Antibody
KC-1291-03 1 mL

STAMBP Antibody

Sign In for Pricing
View Details
P4HA2 (NM_001017973) Human Over-expression Lysate
LY422630 100 µg

P4HA2 (NM_001017973) Human Over-expression Lysate

Sign In for Pricing
View Details
C19orf44 (NM_032207) Human Recombinant Protein
TP312200M 100 µg

C19orf44 (NM_032207) Human Recombinant Protein

Sign In for Pricing
View Details
HLA-DP/-DQ/-DR (MHC II) (CR3/43), CF488A conjugate, 0.1mg/mL
BNC881656-100 1x 100 µL

HLA-DP/-DQ/-DR (MHC II) (CR3/43), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details