SMPD1 Peptide - middle region
SMPD1 Peptide - middle region
Product Specifications
UniProt
E9PPK6
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SMPD1 Rabbit Polyclonal Antibody (orb575560) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740252-100 1x 100 µL
Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (AE-1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
