SMPD1 Peptide - middle region
SMPD1 Peptide - middle region
Product Specifications
UniProt
E9PPK6
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SMPD1 Rabbit Polyclonal Antibody (orb575560) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GM-505-15 1 mL
Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Biotin, 15nm
Sign In for Pricing
View Details 
![CD10 (MME) Mouse Monoclonal Antibody [Clone ID: OTI2A3]](https://cdn.genprice.uk/products/937/68dd18bb061270361e9088e7/imageurl/cf810605.webp)
CF810605 100 µg
CD10 (MME) Mouse Monoclonal Antibody [Clone ID: OTI2A3]
Sign In for Pricing
View Details