ZNF732 Peptide - N-terminal region
ZNF732 Peptide - N-terminal region
Product Specifications
UniProt
B4DXR9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF732 Rabbit Polyclonal Antibody (orb55666) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001131080.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NPDLVTCLEQRKEPYNVKIHKIVARPPAMCSHFTQDHWPVQGIEDSFHKL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Histone H1.0 Recombinant Rabbit Monoclonal Antibody [SD206-04]](https://cdn.genprice.uk/products/992/68dd1c8e061270361ea8241a/imageurl/et1612-24.webp)
ET1612-24 100 µL
Histone H1.0 Recombinant Rabbit Monoclonal Antibody [SD206-04]
Sign In for Pricing
View Details 
BNC473333-100 1x 100 µL
Calbindin 1 (CALB1) (CALB1/3333), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
