ZNF732 Peptide - N-terminal region
ZNF732 Peptide - N-terminal region
Product Specifications
UniProt
B4DXR9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF732 Rabbit Polyclonal Antibody (orb55666) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001131080.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NPDLVTCLEQRKEPYNVKIHKIVARPPAMCSHFTQDHWPVQGIEDSFHKL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC883193-100 1x 100 µL
Prohibitin (Mitochondrial Marker) (PHB/3193), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681543-500 1x 500 µL
Calnexin (Endoplasmic Reticulum Marker) (CANX/1543), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![Biotin Conjugated Human CD63 Recombinant Rabbit Monoclonal Antibody [PSH08-44] - Detector](https://cdn.genprice.uk/products/992/68dd1c8c061270361ea81b33/imageurl/ha722990b.webp)
HA722990B 100 µL
Biotin Conjugated Human CD63 Recombinant Rabbit Monoclonal Antibody [PSH08-44] - Detector
Sign In for Pricing
View Details 
BNUB2580-500 1x 500 µL
CD10 (Membrane Metalloendopeptidase) (MME/2580), 0.2mg/mL
Sign In for Pricing
View Details 