TRIP13 Peptide - N-terminal region
TRIP13 Peptide - N-terminal region
Product Specifications
UniProt
Q15645
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SPTVHVEVHQRGSSTAKKEDINLSVRKLLNRHNIVFGDYTWTEFDEPFLT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6356138-01 0.1 mL
TMC4, NT (TMC4, Transmembrane channel-like protein 4) (MaxLight 650)
Sign In for Pricing
View Details MBS6356138-02 5x 0.1 mL
TMC4, NT (TMC4, Transmembrane channel-like protein 4) (MaxLight 650)
Sign In for Pricing
View Details 
042676-ML490 100 µL
Tcag7.1071, CT (C7orf72, Uncharacterized protein C7orf72) (MaxLight 490) discontinued
Sign In for Pricing
View Details RPC28825-01 Inquire
Recombinant Human Indian hedgehog protein (IHH), partial , Active Protein
Sign In for Pricing
View Details RPC28825-02 100 µg
Recombinant Human Indian hedgehog protein (IHH), partial , Active Protein
Sign In for Pricing
View Details