TRIP13 Peptide - N-terminal region
TRIP13 Peptide - N-terminal region
Product Specifications
UniProt
Q15645
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SPTVHVEVHQRGSSTAKKEDINLSVRKLLNRHNIVFGDYTWTEFDEPFLT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
H9525 96 Tests
Tumor protein p53-inducible Nuclear protein 2 (TP53INP2) Human ELISA Kit
Sign In for Pricing
View Details ARP41643_T100-FITC 100 µL
AGER Antibody - C-terminal region : FITC (ARP41643_T100-FITC)
Sign In for Pricing
View Details bs-3268R-PE-Cy7-TR 20 µL
Phospho-MEF2A (Ser408) Polyclonal Antibody, PE-Cy7 Conjugated
Sign In for Pricing
View Details