Ptpn14 Peptide - N-terminal region
Ptpn14 Peptide - N-terminal region
Product Specifications
UniProt
Q8C3A1
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PTPN14 Rabbit Polyclonal Antibody (orb583243) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HVQCSEHYSETHTSQDSIFPGNEEALYCRSHNSLDLNYLNGTVTNGSVCS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880965-500 1x 500 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LC419774 20 µg
Complement C9 (C9) (NM_001737) Human Over-expression Lysate
Sign In for Pricing
View Details 
LY402432 100 µg
PREI3 (MOB4) (NM_015387) Human Over-expression Lysate
Sign In for Pricing
View Details 