Ptpn14 Peptide - N-terminal region
Ptpn14 Peptide - N-terminal region
Product Specifications
UniProt
Q8C3A1
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PTPN14 Rabbit Polyclonal Antibody (orb583243) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HVQCSEHYSETHTSQDSIFPGNEEALYCRSHNSLDLNYLNGTVTNGSVCS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
HA750243 100 µL
Tyrosine Hydroxylase Recombinant Rabbit monoclonal Antibody
Sign In for Pricing
View Details 
BNC042560-500 1x 500 µL
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIM373), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
#29148 1x 1 mL
Ulex Europaeus Agglutinin I (UEA I), CF®790 Conjugate
Sign In for Pricing
View Details ![Elab Fluor® Violet 540 Mouse IgG2b, κ Isotype Control[MPC-11]](https://cdn.genprice.uk/products/763/68dd14a3061270361e7d1072/imageurl/e-ab-f09812t3.webp)
E-AB-F09812T3-01 20 Tests
Elab Fluor® Violet 540 Mouse IgG2b, κ Isotype Control[MPC-11]
Sign In for Pricing
View Details E-AB-F09812T3-02 100 Tests
Elab Fluor® Violet 540 Mouse IgG2b, κ Isotype Control[MPC-11]
Sign In for Pricing
View Details