Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RSPH6A Peptide - C-terminal region

RSPH6A Peptide - C-terminal region

Product Specifications

Product Name Alternative

RSHL1, RSP4, RSP6, RSPH4B

UniProt

Q9H0K4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RSPH6A Rabbit Polyclonal Antibody (orb587742) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_110412

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MANWVHHTQHILPQGRCTWVNPLQKTEEEEDLGEEEEKADEGPEEVEQEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 19 (BA17), CF568 conjugate, 0.1mg/mL
BNC680666-500 1x 500 µL

Cytokeratin 19 (BA17), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytochrome P450 2A6 (CYP2A6) Human Gene Knockout Kit (CRISPR)
KN422995 1 Kit

Cytochrome P450 2A6 (CYP2A6) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Intervertebral disc
CS703148 5x 5 µm

Tissue FFPE Sections, Intervertebral disc

Sign In for Pricing
View Details
ANKRA2 Antibody
KC-29963-01 50 μL

ANKRA2 Antibody

Sign In for Pricing
View Details
ANKRA2 Antibody
KC-29963-02 100 µL

ANKRA2 Antibody

Sign In for Pricing
View Details
ANKRA2 Antibody
KC-29963-03 1 mL

ANKRA2 Antibody

Sign In for Pricing
View Details