Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RSPH6A Peptide - C-terminal region

RSPH6A Peptide - C-terminal region

Product Specifications

Product Name Alternative

RSHL1, RSP4, RSP6, RSPH4B

UniProt

Q9H0K4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RSPH6A Rabbit Polyclonal Antibody (orb587742) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_110412

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MANWVHHTQHILPQGRCTWVNPLQKTEEEEDLGEEEEKADEGPEEVEQEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Peroxiredoxin 1 (PRDX1) Rabbit Polyclonal Antibody
TA380305 100 µL

Peroxiredoxin 1 (PRDX1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD3E Mouse Monoclonal Antibody [Clone ID: CA-3]
AM20601PU-N 100 µg

CD3E Mouse Monoclonal Antibody [Clone ID: CA-3]

Sign In for Pricing
View Details
OR5B17 Human Gene Knockout Kit (CRISPR)
KN423023 1 Kit

OR5B17 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
OR2Z1 (N-term) Rabbit Polyclonal Antibody
AP53045PU-N 400 µL

OR2Z1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ARSA (NM_001085425) Human Over-expression Lysate
LY425979 100 µg

ARSA (NM_001085425) Human Over-expression Lysate

Sign In for Pricing
View Details
Ferritin Heavy Chain Recombinant Rabbit Monoclonal Antibody [JM22-36]
ET1705-55 100 µL

Ferritin Heavy Chain Recombinant Rabbit Monoclonal Antibody [JM22-36]

Sign In for Pricing
View Details