SMCR8 Peptide - C-terminal region
SMCR8 Peptide - C-terminal region
Product Specifications
UniProt
Q8TEV9
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SMCR8 Rabbit Polyclonal Antibody (orb587752) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: STYYLHVQSMLTQLCSKAFLYTFCHHLHLPTHDKETEELVASRQMSFLKL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![galectin 9 (LGALS9) Mouse Monoclonal Antibody [Clone ID: OTI1D12]](https://cdn.genprice.uk/products/937/68dd18b9061270361e907ec3/imageurl/cf806323.webp)
CF806323 100 µg
galectin 9 (LGALS9) Mouse Monoclonal Antibody [Clone ID: OTI1D12]
Sign In for Pricing
View Details 