SMCR8 Peptide - C-terminal region
SMCR8 Peptide - C-terminal region
Product Specifications
UniProt
Q8TEV9
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SMCR8 Rabbit Polyclonal Antibody (orb587752) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: STYYLHVQSMLTQLCSKAFLYTFCHHLHLPTHDKETEELVASRQMSFLKL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC681853-100 1x 100 µL
TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) (rNX2.1/690), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941844-100 1x 100 µL
CD79b (B-Cell Marker) (IGB/1844), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TRC-D232070-1MG 1 mg
3'-Deoxyadenosine 5’-Triphosphate Triethylamine Salt
Sign In for Pricing
View Details