Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM116 Peptide - C-terminal region

TMEM116 Peptide - C-terminal region

Product Specifications

UniProt

Q8NCL8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMEM116 Rabbit Polyclonal Antibody (orb327122) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QRVRFYPVAFFCCWGPAVILMIIKLTKPQDTKLHMALYVLQALTATSQGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DC Current Meter MR-100
1091500/15 1 Each

DC Current Meter MR-100

Sign In for Pricing
View Details
TLR7 Polyclonal Antibody, PE-Cy7 Conjugated
bs-41320R-PE-Cy7 100 µL

TLR7 Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
ATPBD4 (DPH6) (NM_080650) Human Over-expression Lysate
LH13476V 100 µg

ATPBD4 (DPH6) (NM_080650) Human Over-expression Lysate

Sign In for Pricing
View Details
Atto Oxa12 5 umol scale
26-6982-06 1 Each

Atto Oxa12 5 umol scale

Sign In for Pricing
View Details
Mmu-miR-673-5p inhibitor
HY-RI03489-01 5 nmol

Mmu-miR-673-5p inhibitor

Sign In for Pricing
View Details
Mmu-miR-673-5p inhibitor
HY-RI03489-02 20 nmol

Mmu-miR-673-5p inhibitor

Sign In for Pricing
View Details