Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM116 Peptide - C-terminal region

TMEM116 Peptide - C-terminal region

Product Specifications

UniProt

Q8NCL8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMEM116 Rabbit Polyclonal Antibody (orb327122) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QRVRFYPVAFFCCWGPAVILMIIKLTKPQDTKLHMALYVLQALTATSQGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Hemopexin (HPX) Protein (Active)
abx692029 100 µg

Mouse Hemopexin (HPX) Protein (Active)

Sign In for Pricing
View Details
ZNF142 Antibody
GWB-MM808G 50 µg

ZNF142 Antibody

Sign In for Pricing
View Details
NSUN5C Protein Vector (Human) (pPM-C-His)
PV028960 500 ng

NSUN5C Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
PER-3 Polyclonal Antibody, PE-Cy5 Conjugated
bs-4498R-PE-Cy5 100 µL

PER-3 Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
PON1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
37227124 3x 1.0µg DNA

PON1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
5-[ (2-O-A-D-Glucopyranosyl-b-D-galactopyranosyl) oxy]-L-lysine
434702 1 mg

5-[ (2-O-A-D-Glucopyranosyl-b-D-galactopyranosyl) oxy]-L-lysine

Sign In for Pricing
View Details