Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR31 Peptide - middle region

WDR31 Peptide - middle region

Product Specifications

UniProt

Q8NA23

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WDR31 Rabbit Polyclonal Antibody (orb587797) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_660284

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MWDLHGSSQPRQQLCGHAMVVTGLAVSPDSSQLCTGSRDNTLLLWDVVTG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

R 428
TRC-R060020-1MG 1 mg

R 428

Sign In for Pricing
View Details
Itopride N-Oxide
TRC-I931510-50MG 50 mg

Itopride N-Oxide

Sign In for Pricing
View Details
MASPIN (SERPINB5) Rabbit Polyclonal Antibody
AP06801PU-N 100 µg

MASPIN (SERPINB5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HNMT Rabbit Polyclonal Antibody
TA377156 100 µL

HNMT Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
WRB Polyclonal Antibody
E-AB-62952-01 60 µL

WRB Polyclonal Antibody

Sign In for Pricing
View Details
WRB Polyclonal Antibody
E-AB-62952-02 120 µL

WRB Polyclonal Antibody

Sign In for Pricing
View Details