Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR31 Peptide - middle region

WDR31 Peptide - middle region

Product Specifications

UniProt

Q8NA23

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WDR31 Rabbit Polyclonal Antibody (orb587797) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_660284

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MWDLHGSSQPRQQLCGHAMVVTGLAVSPDSSQLCTGSRDNTLLLWDVVTG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aramite
TRC-A765153-50MG 50 mg

Aramite

Sign In for Pricing
View Details
Clinafloxacin
TRC-C579003-50MG 50 mg

Clinafloxacin

Sign In for Pricing
View Details
Mouse FE (Ferritin) ELISA Kit
E-EL-M0491-01 24 Tests

Mouse FE (Ferritin) ELISA Kit

Sign In for Pricing
View Details
Mouse FE (Ferritin) ELISA Kit
E-EL-M0491-02 48 Tests

Mouse FE (Ferritin) ELISA Kit

Sign In for Pricing
View Details
Mouse FE (Ferritin) ELISA Kit
E-EL-M0491-03 96 Tests

Mouse FE (Ferritin) ELISA Kit

Sign In for Pricing
View Details
THADA Rabbit Polyclonal Antibody
TA365902 100 µL

THADA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details