Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHISA7 Peptide - middle region

SHISA7 Peptide - middle region

Product Specifications

UniProt

A6NL88

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SHISA7 Rabbit Polyclonal Antibody (orb587814) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001138648

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: INVPRALVDILRHQAGPGTRPDRARSSSLTPGIGGPDSMPPRTPKNLYNT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MA104 TIER4 Frozen Stock
65-TIER4 each

MA104 TIER4 Frozen Stock

Sign In for Pricing
View Details
Anti-IL13 (GSK679586) Biosimilar (Monoclonal, IgG)
A136414 100 µL

Anti-IL13 (GSK679586) Biosimilar (Monoclonal, IgG)

Sign In for Pricing
View Details
Cept1 Mouse Pre-designed siRNA Set A
HY-RS20881 1 Set

Cept1 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
Phosphodiesterase 4B (PDE4B) (FITC)
P4072-03-FITC 100 µL

Phosphodiesterase 4B (PDE4B) (FITC)

Sign In for Pricing
View Details
hsa-miR-3923 miRNA Inhibitor
MBS8293992-01 10 nmol

hsa-miR-3923 miRNA Inhibitor

Sign In for Pricing
View Details
hsa-miR-3923 miRNA Inhibitor
MBS8293992-02 20 nmol

hsa-miR-3923 miRNA Inhibitor

Sign In for Pricing
View Details