SHISA7 Peptide - middle region
SHISA7 Peptide - middle region
Product Specifications
UniProt
A6NL88
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SHISA7 Rabbit Polyclonal Antibody (orb587814) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001138648
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: INVPRALVDILRHQAGPGTRPDRARSSSLTPGIGGPDSMPPRTPKNLYNT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
P9054-18B-FITC 100 µL
PROSTATE SPECIFIC ANTIGEN (PSA, Kallikrein-3, Kallikrein III, Seminin, Semenogelase, γ-Seminoprotein, P-30 antigen, KLK3) (FITC) discontinued
Sign In for Pricing
View Details E45M14213 100 µg
Sterol carrier protein 2 (SCP2) Mouse Monoclonal Antibody [Clone:3F5]
Sign In for Pricing
View Details 
MBS710808-01 0.1 mL
Rabbit anti-human premature ovarian failure, 1B polyclonal Antibody
Sign In for Pricing
View Details MBS710808-02 5x 0.1 mL
Rabbit anti-human premature ovarian failure, 1B polyclonal Antibody
Sign In for Pricing
View Details