SOHLH2 Peptide - N-terminal region
SOHLH2 Peptide - N-terminal region
Product Specifications
UniProt
Q9NX45
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SOHLH2 Rabbit Polyclonal Antibody (orb587821) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ALKLEQESKAYQKINNERRTYLAEMSQGSGLHQVSKRQQVDQLPRMQENL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940952-100 1x 100 µL
Human IgG Immunoglobulin (B33/20), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LY423333 100 µg
RUNDC2B (NM_001012391) Human Over-expression Lysate
Sign In for Pricing
View Details 
![PCNA Recombinant Mouse Monoclonal Antibody [A6-G11-R]](https://cdn.genprice.uk/products/992/68dd1c8a061270361ea81036/imageurl/ha601172.webp)
HA601172 100 µL
PCNA Recombinant Mouse Monoclonal Antibody [A6-G11-R]
Sign In for Pricing
View Details