Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC30 Peptide - C-terminal region

CCDC30 Peptide - C-terminal region

Product Specifications

UniProt

Q5VVM6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC30 Rabbit Polyclonal Antibody (orb587824) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GKGLVESFASLQETEEIKSKEAMASSKSPEKSPENLVCSQNSEAGYINVA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rbm7 Rat shRNA Lentiviral Particle (Locus ID 315634)
TL706686V 500 µL Each

Rbm7 Rat shRNA Lentiviral Particle (Locus ID 315634)

Sign In for Pricing
View Details
PAPSS2 Antibody
MBS9524277-01 0.04 mL

PAPSS2 Antibody

Sign In for Pricing
View Details
PAPSS2 Antibody
MBS9524277-02 0.1 mL

PAPSS2 Antibody

Sign In for Pricing
View Details
PAPSS2 Antibody
MBS9524277-03 0.2 mL

PAPSS2 Antibody

Sign In for Pricing
View Details
PAPSS2 Antibody
MBS9524277-04 5x 0.2 mL

PAPSS2 Antibody

Sign In for Pricing
View Details
Phospho-tyrosine HGFR [Y1230] (MET) polyclonal antibody
ABP-PAB-11675 100 ug

Phospho-tyrosine HGFR [Y1230] (MET) polyclonal antibody

Sign In for Pricing
View Details