TMEM236 Peptide - middle region
TMEM236 Peptide - middle region
Product Specifications
UniProt
Q5W0B7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TMEM236 Rabbit Polyclonal Antibody (orb327167) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_003959978
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YPLRGSQKSSENGHIHSTSLQHIKTVTEQVRQSPENAASPQATNSTQVSQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSH033391-01 10 µg
Recombinant Human S100A6 Protein (E.coli, His Tag)
Sign In for Pricing
View Details PKSH033391-02 50 µg
Recombinant Human S100A6 Protein (E.coli, His Tag)
Sign In for Pricing
View Details 
BNC942267-500 1x 500 µL
Cell Division Cycle 34 homolog (CPTC-CDC34-2), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401384-500 1x 500 µL
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1384), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![NK1.1 Recombinant Rabbit Monoclonal Antibody [PSH08-46]](https://cdn.genprice.uk/products/992/68dd1c8d061270361ea81ee0/imageurl/ha722992.webp)
HA722992 100 µL
NK1.1 Recombinant Rabbit Monoclonal Antibody [PSH08-46]
Sign In for Pricing
View Details