TMEM236 Peptide - middle region
TMEM236 Peptide - middle region
Product Specifications
UniProt
Q5W0B7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TMEM236 Rabbit Polyclonal Antibody (orb327167) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_003959978
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YPLRGSQKSSENGHIHSTSLQHIKTVTEQVRQSPENAASPQATNSTQVSQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Ubiquitin (UBB) Mouse Monoclonal Antibody [Clone ID: 10C2-2]](https://cdn.genprice.uk/products/937/68dd189b061270361e8fc618/imageurl/am10231su-n.webp)
AM10231SU-N 1 mL
Ubiquitin (UBB) Mouse Monoclonal Antibody [Clone ID: 10C2-2]
Sign In for Pricing
View Details 
#29079-KIT 1 Kit
CheetahTM FLEX HotStart Taq (500 U Taq with Buffer Pack)
Sign In for Pricing
View Details 
PKSH031388 100 µg
Recombinant Human Nectin-3/PVRL3 Protein (His Tag)
Sign In for Pricing
View Details 
![NUDT6 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9D5]](https://cdn.genprice.uk/products/937/6868c333994c49e6dc3f180e/imageurl/ta502331am.webp)
TA502331AM 100 µL
NUDT6 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9D5]
Sign In for Pricing
View Details 
TRC-D199050-50G 50 g
DEAE-Cellulose, (approx. 70% moisture content)
Sign In for Pricing
View Details