Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RTL8A Peptide - N-terminal region

RTL8A Peptide - N-terminal region

Product Specifications

Product Name Alternative

CXX1b, MAR8A, SIRH6, FAM127B

UniProt

Q9BWD3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RTL8A Rabbit Polyclonal Antibody (orb327169) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GRVQLMKALLAGPLRPAARRWRNPIPFPETFDGDTDRLPEFIVQTSSYMF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Cecum
CS805266 5x 5 µm

Tissue FFPE Sections, Cecum

Sign In for Pricing
View Details
1700123K08Rik Mouse Gene Knockout Kit (CRISPR)
KN500176 1 Kit

1700123K08Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human ABCA9 activation kit by CRISPRa
GA107055 1 Kit

Human ABCA9 activation kit by CRISPRa

Sign In for Pricing
View Details
Tm9sf1 Mouse Gene Knockout Kit (CRISPR)
KN517648 1 Kit

Tm9sf1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Blocks, Kidney
CB506059 1 Block

Frozen Tissue Blocks, Kidney

Sign In for Pricing
View Details
Lapaquistat Acetate
TRC-L175500-25MG 25 mg

Lapaquistat Acetate

Sign In for Pricing
View Details