Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXD4L1 Peptide - N-terminal region

FOXD4L1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FOXD5, bA395L14.1

UniProt

Q9NU39

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FOXD4L1 Rabbit Polyclonal Antibody (orb587834) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036316

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PRSTPQRSLRDSDGEDGKIDVLGEEEDEDEVEDEEEEASQKFLEQSLQPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Breast
CR560707 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
CF®568 TCO
#96044 1x 1 mg

CF®568 TCO

Sign In for Pricing
View Details
C12orf77 (NM_001101339) Human Recombinant Protein
TP761724 50 µg

C12orf77 (NM_001101339) Human Recombinant Protein

Sign In for Pricing
View Details
Neurofilament (H+L) (NF421 + NFL736), CF640R conjugate, 0.1mg/mL
BNC400756-100 1x 100 µL

Neurofilament (H+L) (NF421 + NFL736), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SIGLEC7 Antibody
KC-3652-01 50 μL

SIGLEC7 Antibody

Sign In for Pricing
View Details
SIGLEC7 Antibody
KC-3652-02 100 µL

SIGLEC7 Antibody

Sign In for Pricing
View Details