FOXD4L1 Peptide - N-terminal region
FOXD4L1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
FOXD5, bA395L14.1
UniProt
Q9NU39
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FOXD4L1 Rabbit Polyclonal Antibody (orb587834) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_036316
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PRSTPQRSLRDSDGEDGKIDVLGEEEDEDEVEDEEEEASQKFLEQSLQPG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Caspase-5 Recombinant Rabbit Monoclonal Antibody [SD203-2]](https://cdn.genprice.uk/products/992/68dd1c8a061270361ea811f0/imageurl/et1612-29.webp)
ET1612-29 100 µL
Caspase-5 Recombinant Rabbit Monoclonal Antibody [SD203-2]
Sign In for Pricing
View Details 