LGALS9 Peptide - middle region
LGALS9 Peptide - middle region
Product Specifications
UniProt
O00182
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LGALS9 Rabbit Polyclonal Antibody (orb587841) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-D965740-5MG 5 mg
4"-Desmorpholino,-4"-morpholin-3-on-4-yl Momelotinib Benzamide
Sign In for Pricing
View Details 
LY400970 100 µg
JNK1 (MAPK8) (NM_002750) Human Over-expression Lysate
Sign In for Pricing
View Details