PRAMEF11 Peptide - middle region
PRAMEF11 Peptide - middle region
Product Specifications
Product Name Alternative
RP5-845O24.2
UniProt
O60813
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PRAMEF11 Rabbit Polyclonal Antibody (orb587848) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001139816
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TQFTPYLGHLRNLQKLVLSHMDVSRYVSPEQKKEIVTQFTTQFLKLRCLQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
172151-AF-ML405 100 µL
SUMO-2/3 (HSMT3, Sentrin 2, Small Ubiquitin like Modifier 2, Small Ubiquitin like Modifier Protein 3, SMT3A, SMT3B, SMT3 Homolog 1, SMT3H1, SMT3 Homolog 2, SMT3H2, SMT3 Homolog, SMT3 Suppressor of mif two 3 Homolog 1, SMT3 Suppressor of mif two 3 Homolog 2, SMT3 Suppressor of mif two 3 Homolog 3, Suppressor of mif two 3 Homolog 2, Suppressor of mif two 3 Homolog 3, Ubiquitin like Protein SMT3A, Ubiquitin like Protein SMT3B) (BSA & Azide Free) (MaxLight 405) discontinued
Sign In for Pricing
View Details 
ELI-08303m 96 Tests
Mouse Metabotropic glutamate receptor 8, Grm8 ELISA KIT
Sign In for Pricing
View Details 
13365121 3x 1.0µg DNA
BMP2KL CRISPRa sgRNA lentivector (set of three targets)(Human)
Sign In for Pricing
View Details