Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRAMEF11 Peptide - middle region

PRAMEF11 Peptide - middle region

Product Specifications

Product Name Alternative

RP5-845O24.2

UniProt

O60813

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRAMEF11 Rabbit Polyclonal Antibody (orb587848) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001139816

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TQFTPYLGHLRNLQKLVLSHMDVSRYVSPEQKKEIVTQFTTQFLKLRCLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR10V1 Antibody
CSB-PA009746-01 50 µg

OR10V1 Antibody

Sign In for Pricing
View Details
OR10V1 Antibody
CSB-PA009746-02 100 µg

OR10V1 Antibody

Sign In for Pricing
View Details
C15ORF59 Protein Lysate
OCOA15837-20UG 20 µg

C15ORF59 Protein Lysate

Sign In for Pricing
View Details
NUP93 Antibody
E38QA5322 100 µL

NUP93 Antibody

Sign In for Pricing
View Details
Aven (NM_001165935) Mouse Tagged Lenti ORF Clone
MR215907L4 10 µg

Aven (NM_001165935) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CDCA3 Rabbit Polyclonal Antibody (BF555)
orb2389094 100 µL

CDCA3 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details