RFX8 Peptide - C-terminal region
RFX8 Peptide - C-terminal region
Product Specifications
UniProt
Q6ZV50
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RFX8 Rabbit Polyclonal Antibody (orb327180) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AIINQGTLATSKKALASDRSGADELENNPEMKCLRNLISLLGTSTDLRVF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC042781-100 1x 100 µL
Cathepsin D (Tumor Marker) (CTSD/2781), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
EA101169 1x 48 Well (Pre-Coated)
Human CD50 ELISA Kit, 1 x 48-well (pre-coated)
Sign In for Pricing
View Details