RFX8 Peptide - C-terminal region
RFX8 Peptide - C-terminal region
Product Specifications
UniProt
Q6ZV50
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RFX8 Rabbit Polyclonal Antibody (orb327180) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AIINQGTLATSKKALASDRSGADELENNPEMKCLRNLISLLGTSTDLRVF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Bcl-2 Mouse Monoclonal Antibody [F7-1-A1]](https://cdn.genprice.uk/products/992/68dd1c8b061270361ea81620/imageurl/m1206-4.webp)
BNC683112-100 1x 100 µL
CD95 / FAS / TNFRSF6 (FAS/3112), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TA366808 100 µL
Glucocorticoid Receptor (NR3C1) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details