Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HEY1 Peptide - N-terminal region

HEY1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BHLHb31, CHF2, HERP2, HESR1, HRT-1, OAF1

UniProt

Q9Y5J3

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HEY1 Rabbit Polyclonal Antibody (orb587882) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036390

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSALGSMSPTTSSQILARKRRRGIIEKRRRDRINNSLSELRRLVPSAFEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC Anti-Mouse CD122/IL-2RB Antibody[5H4]
E-AB-F1029E-01 50 Tests

APC Anti-Mouse CD122/IL-2RB Antibody[5H4]

Sign In for Pricing
View Details
APC Anti-Mouse CD122/IL-2RB Antibody[5H4]
E-AB-F1029E-02 100 Tests

APC Anti-Mouse CD122/IL-2RB Antibody[5H4]

Sign In for Pricing
View Details
APC Anti-Mouse CD122/IL-2RB Antibody[5H4]
E-AB-F1029E-03 2x 100 Tests

APC Anti-Mouse CD122/IL-2RB Antibody[5H4]

Sign In for Pricing
View Details
Gibberellic Acid Acetate
TRC-G377530-500MG 500 mg

Gibberellic Acid Acetate

Sign In for Pricing
View Details
beta Defensin 3 (DEFB103A) (6-22) Mouse Monoclonal Antibody [Clone ID: L3-18b-E1]
AM02222PU-N 100 µg

beta Defensin 3 (DEFB103A) (6-22) Mouse Monoclonal Antibody [Clone ID: L3-18b-E1]

Sign In for Pricing
View Details
TGF beta Receptor II (TGFBR2) Rabbit Polyclonal Antibody
AP20273PU-N 100 µg

TGF beta Receptor II (TGFBR2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details