Nfe2 Peptide - C-terminal region
Nfe2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
45kDa, NF-E2, p45, p45NFE2, p45nf-e2
UniProt
Q07279
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Nfe2 Rabbit Polyclonal Antibody (orb573740) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_032711
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ARGEADRTLEVMRQQLAELYHDIFQHLRDESGNSYSPEEYVLQQAADGAI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E-BC-K205-S-01 50 Assays (46 samples)
Low-Density Lipoprotein Cholesterol (LDL-C) Colorimetric Assay Kit (Double Reagents)
Sign In for Pricing
View Details E-BC-K205-S-02 100 Assays (96 samples)
Low-Density Lipoprotein Cholesterol (LDL-C) Colorimetric Assay Kit (Double Reagents)
Sign In for Pricing
View Details 
BNC943046-100 1x 100 µL
MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3046), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472489-100 1x 100 µL
P21WAF1 (Tumor Suppressor Protein) (CIP1/2489R), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNCB2896-100 1x 100 µL
VLDL-Receptor (Very Low Density Lipoprotein Receptor) (VLDLR/2896R), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
I-6803-1 1 mg
Ferritin Conjugated Sambucus nigra (Elderberry Bark) -SNA-II-
Sign In for Pricing
View Details