Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nfe2 Peptide - C-terminal region

Nfe2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

45kDa, NF-E2, p45, p45NFE2, p45nf-e2

UniProt

Q07279

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Nfe2 Rabbit Polyclonal Antibody (orb573740) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032711

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ARGEADRTLEVMRQQLAELYHDIFQHLRDESGNSYSPEEYVLQQAADGAI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE Anti-Mouse CD80 Antibody[16-10A1]
E-AB-F0992UD-01 25 µg

PE Anti-Mouse CD80 Antibody[16-10A1]

Sign In for Pricing
View Details
PE Anti-Mouse CD80 Antibody[16-10A1]
E-AB-F0992UD-02 100 µg

PE Anti-Mouse CD80 Antibody[16-10A1]

Sign In for Pricing
View Details
trans-Zeatin-O-beta-D-glucuronide
TRC-Z273025-25MG 25 mg

trans-Zeatin-O-beta-D-glucuronide

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS625688 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
BRAP Antibody
KC-2302-01 50 μL

BRAP Antibody

Sign In for Pricing
View Details
BRAP Antibody
KC-2302-02 100 µL

BRAP Antibody

Sign In for Pricing
View Details