MEOX1 Peptide - C-terminal region
MEOX1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
MOX1
UniProt
P50221
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MEOX1 Rabbit Polyclonal Antibody (orb574019) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_054705
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPISPNGQDP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740977-100 1x 100 µL
TGF-beta (1D11.16.8), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040226-500 1x 500 µL
Pmel17 / gp100 / SILV (NKI-beteb), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880646-100 1x 100 µL
Von Willebrand Factor (3E2D10 + VWF635), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details