Wnt1 Peptide - C-terminal region
Wnt1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
Int-1, Wnt-1, sw, swaying
UniProt
P04426
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Wnt1 Rabbit Polyclonal Antibody (orb574056) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_067254
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC402985-100 1x 100 µL
BRCA1 (Breast Marker) (BRCA1/2985), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details