Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Smad6 Peptide - C-terminal region

Smad6 Peptide - C-terminal region

Product Specifications

UniProt

O35182

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Smad6 Rabbit Polyclonal Antibody (orb574336) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PDGVWAYNRGEHPIFVNSPTLDAPGGRALVVRKVPPGYSIKVFDFERSGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SESN1 Antibody Picoband®, FITC Conjugate
A05559-2-FITC 100 µg/Vial

Anti-SESN1 Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details
HSPD1P18 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1002306 1.0 µg DNA

HSPD1P18 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Recombinant Mouse RBM25 Protein, His (Fc)-Avi-tagged
RBM25-7475M 50 µg

Recombinant Mouse RBM25 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Canine MMP1 ELISA kit
55R-2038 96 tests

Canine MMP1 ELISA kit

Sign In for Pricing
View Details
2- (2-acetyl-4-bromophenoxy) acetic acid
JBA84951-01 0.5 g

2- (2-acetyl-4-bromophenoxy) acetic acid

Sign In for Pricing
View Details
2- (2-acetyl-4-bromophenoxy) acetic acid
JBA84951-02 5 g

2- (2-acetyl-4-bromophenoxy) acetic acid

Sign In for Pricing
View Details