Mbnl2 Peptide - middle region
Mbnl2 Peptide - middle region
Product Specifications
UniProt
F2Z3T4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Mbnl2 Rabbit Polyclonal Antibody (orb577845) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IACFDSLKGRCSRENCKYLHPPTHLKTQLEINGRNNLIQQKTAAAMLAQQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![MAFB Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A6]](https://cdn.genprice.uk/products/937/6868c385994c49e6dc3f9525/imageurl/ta800291bm.webp)
TA800291BM 100 µL
MAFB Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A6]
Sign In for Pricing
View Details 
