Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mbnl2 Peptide - middle region

Mbnl2 Peptide - middle region

Product Specifications

UniProt

F2Z3T4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mbnl2 Rabbit Polyclonal Antibody (orb577845) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IACFDSLKGRCSRENCKYLHPPTHLKTQLEINGRNNLIQQKTAAAMLAQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAOK2 (NM_004783) Human Over-expression Lysate
LC401503 20 µg

TAOK2 (NM_004783) Human Over-expression Lysate

Sign In for Pricing
View Details
UAP56 (DDX39B) Rabbit Polyclonal Antibody
TA367343 100 µL

UAP56 (DDX39B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1,2,5-Pentanetriol
TRC-P227418-500MG 500 mg

1,2,5-Pentanetriol

Sign In for Pricing
View Details
OTOA (NM_001161683) Human Over-expression Lysate
LY431663 100 µg

OTOA (NM_001161683) Human Over-expression Lysate

Sign In for Pricing
View Details
Human LIMS2 activation kit by CRISPRa
GA110877 1 Kit

Human LIMS2 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS633519 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details