Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC44A4 Peptide - middle region

SLC44A4 Peptide - middle region

Product Specifications

Product Name Alternative

C6orf29, CTL4, NG22

UniProt

Q53GD3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC44A4 Rabbit Polyclonal Antibody (orb578568) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079533

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MMSTMFYPLVTFVLLLICIAYWAMTALYLATSGQPQYVLWASNISSPGCE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYO7B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1379407 1.0 µg DNA

MYO7B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
PDZD9 Protein Vector (Rat) (pPM-C-HA)
PV293320 500 ng

PDZD9 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
LINC00330 ORF Vector (Human) (pORF)
ORF022847 1.0 µg DNA

LINC00330 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
3-Chloro-4-methyl-2- (methylthio) pyridine
OR1088892 250 mg

3-Chloro-4-methyl-2- (methylthio) pyridine

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Vanin 1 (VNN1)
MBS2145969-01 0.1 mL

Cy3-Linked Monoclonal Antibody to Vanin 1 (VNN1)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Vanin 1 (VNN1)
MBS2145969-02 0.2 mL

Cy3-Linked Monoclonal Antibody to Vanin 1 (VNN1)

Sign In for Pricing
View Details