Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC44A4 Peptide - middle region

SLC44A4 Peptide - middle region

Product Specifications

Product Name Alternative

C6orf29, CTL4, NG22

UniProt

Q53GD3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC44A4 Rabbit Polyclonal Antibody (orb578568) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079533

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MMSTMFYPLVTFVLLLICIAYWAMTALYLATSGQPQYVLWASNISSPGCE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Laeverin (LVRN) (NM_173800) Human Over-expression Lysate
LS206338 100 µg

Laeverin (LVRN) (NM_173800) Human Over-expression Lysate

Sign In for Pricing
View Details
GFAP (N206A/8) Recombinant Chicken Chimeric mAb FL650 Conjugate Antibody
orb3166926 200 µL

GFAP (N206A/8) Recombinant Chicken Chimeric mAb FL650 Conjugate Antibody

Sign In for Pricing
View Details
Recombinant PHF8 Rabbit mAb
E38MA4237 100 µL

Recombinant PHF8 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Mouse Cathepsin H (CTSH)
RPU51380-01 50 µg

Recombinant Mouse Cathepsin H (CTSH)

Sign In for Pricing
View Details
Recombinant Mouse Cathepsin H (CTSH)
RPU51380-02 100 µg

Recombinant Mouse Cathepsin H (CTSH)

Sign In for Pricing
View Details
Recombinant Mouse Cathepsin H (CTSH)
RPU51380-03 1 mg

Recombinant Mouse Cathepsin H (CTSH)

Sign In for Pricing
View Details